Structure of PDB 6ppf Chain L

Receptor sequence

>6ppfL (length=128) Species: 1423 (Bacillus subtilis) [Search protein sequence]

MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGMPLFQRLPKRGFT
NINRKEYAVVNLDKLNGFAEGTEVTPELLLETGVISKLNAGVKILGNGKL
EKKLTVKANKFSASAKEAVEAAGGTAEV

3D structure

PDB

6ppf Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	L3 H4 R13 K14 R16 N17 R18 G20 R21 G22 G24 S25 G28 K29 T30 A31 G32 K33 G34 H35 K36 F58 Q59 P62 K63 R64 G65 F66 I69 R71 N78 S103 K104 K110 L112 G113 N114 S129 A130 S131	L3 H4 R13 K14 R16 N17 R18 G20 R21 G22 G24 S25 G28 K29 T30 A31 G32 K33 G34 H35 K36 F41 Q42 P45 K46 R47 G48 F49 I52 R54 N61 S86 K87 K93 L95 G96 N97 S112 A113 S114

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6ppf, PDBe:6ppf, PDBj:6ppf
PDBsum	6ppf
PubMed	31665744
UniProt	P19946\|RL15_BACSU Large ribosomal subunit protein uL15 (Gene Name=rplO)