Structure of PDB 6pnj Chain L

Receptor sequence

>6pnjL (length=156) Species: 98439 (Fischerella thermalis PCC 7521) [Search protein sequence]

IIKPFKGDPCLGNLSTPINDSPLAKAFINNLPAYRKGLTPFMRGLEIGMA
HGYFLVGPEVVIGPLRESAHGANLSGLITAIYIAVSACLGISIFAITTFQ
GNPKGSYDSLRPLRTREEWSQLNGGIFLGAMGGAIFAYLLLENFDALDAI
LRGAVN

3D structure

PDB

6pnj The structure of Photosystem I acclimated to far-red light illuminates an ecologically important acclimation process in photosynthesis

Chain

Resolution

3.19 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	I13 T27	I2 T16
BS02	CLA	L	I29 I39	I18 I28
BS03	CLA	L	P69 E70 I73 P75	P58 E59 I62 P64
BS04	CLA	L	E70 P75	E59 P64
BS05	CLA	L	H62 I94 F105	H51 I83 F94
BS06	CA	L	P75 E78	P64 E67
BS07	CLA	L	F38 N41 R46 M53 E57 M60	F27 N30 R35 M42 E46 M49
BS08	CLA	L	P43 A44 I58 H62 F65	P32 A33 I47 H51 F54
BS09	CLA	L	Y64 F65 G68 P69 V72 L156 F160	Y53 F54 G57 P58 V61 L140 F144
BS10	CLA	L	L100 S103	L89 S92
BS11	CLA	L	I166 V171 N172	I150 V155 N156

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6pnj, PDBe:6pnj, PDBj:6pnj
PDBsum	6pnj
PubMed
UniProt	G6FMF1

[Back to BioLiP]