Structure of PDB 6pgk Chain L

Receptor sequence
>6pgkL (length=151) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
LVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMA
HGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQK
GGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFLLENFLVVDGIMTGLF
N
3D structure
PDB6pgk Membrane protein megahertz crystallography at the European XFEL.
ChainL
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA L H16 T19 I21 S22 H13 T16 I18 S19
BS02 CLA L P61 W62 L65 P67 P58 W59 L62 P64
BS03 CLA L W62 P67 L87 W59 P64 L84
BS04 CA L P67 D70 P64 D67
BS05 CLA L N33 L34 R38 E49 M52 N30 L31 R35 E46 M49
BS06 CLA L I21 P35 V50 H54 I18 P32 V47 H51
BS07 CLA L Y56 F57 G60 P61 V63 F142 Y53 F54 G57 P58 V60 F139
BS08 CLA L A91 A94 A88 A91
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pgk, PDBe:6pgk, PDBj:6pgk
PDBsum6pgk
PubMed31685819
UniProtQ8DGB4|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]