Structure of PDB 6nwa Chain L

Receptor sequence

>6nwaL (length=154) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]

SNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEV
GMAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVT
FQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFR
GLFN

3D structure

PDB

6nwa The structure of the stress-induced photosystem I-IsiA antenna supercomplex.

Chain

Resolution

3.48 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	V8 T22	V5 T19
BS02	CLA	L	H19 I24 T30	H16 I21 T27
BS03	CLA	L	P64 W65 L68 P70	P61 W62 L65 P67
BS04	CLA	L	W65 P70 I83 A87	W62 P67 I80 A84
BS05	CLA	L	F33 N36 L37 R41 E52 M55	F30 N33 L34 R38 E49 M52
BS06	CLA	L	P38 A39 E52 V53 H57 F60	P35 A36 E49 V50 H54 F57
BS07	CLA	L	Y59 F60 G63 P64 L67 A138 L142 L145 F152	Y56 F57 G60 P61 L64 A135 L139 L142 F149
BS08	CA	L	P70 L71 R72 D73	P67 L68 R69 D70

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0005886	plasma membrane
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6nwa, PDBe:6nwa, PDBj:6nwa
PDBsum	6nwa
PubMed	31133699
UniProt	P37277\|PSAL_SYNY3 Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]