Structure of PDB 6neq Chain L

Receptor sequence
>6neqL (length=109) Species: 9913 (Bos taurus) [Search protein sequence]
ATLNQLHRRGPPKFPPSKPGPTEGRPQLKGVVLRTFIRKPKKPNSANRKC
CRVRLSTGREAVCFIPGEGHNLQEHHVVLVQGGRTQDLPGVKLKVVRGKY
DCGHVQKKK
3D structure
PDB6neq Structure of Human Mitochondrial Translation Initiation Factor 3 Bound to the Small Ribosomal Subunit.
ChainL
Resolution3.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L A31 T32 N34 Q35 R38 F44 K48 G54 R55 P56 Q57 K59 K72 S75 A76 N77 R78 K79 G97 E98 G112 Q116 D117 K122 K129 H134 K138 A1 T2 N4 Q5 R8 F14 K18 G24 R25 P26 Q27 K29 K42 S45 A46 N47 R48 K49 G67 E68 G82 Q86 D87 K92 K99 H104 K108
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6neq, PDBe:6neq, PDBj:6neq
PDBsum6neq
PubMed30677741
UniProtQ29RU1|RT12_BOVIN Small ribosomal subunit protein uS12m (Gene Name=MRPS12)

[Back to BioLiP]