Structure of PDB 6lu1 Chain L

Receptor sequence
>6lu1L (length=135) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
LVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMA
HGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQK
GGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFL
3D structure
PDB6lu1 Cryo-EM structure of a functional monomeric Photosystem I from Thermosynechococcus elongatus reveals red chlorophyll cluster.
ChainL
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA L V5 P20 V2 P17
BS02 CLA L T19 I21 S22 V27 I31 T16 I18 S19 V24 I28
BS03 CLA L P61 W62 L65 G66 P58 W59 L62 G63
BS04 CLA L N33 R38 E49 N30 R35 E46
BS05 CLA L P35 V50 A53 H54 F57 P32 V47 A50 H51 F54
BS06 CLA L Y56 F57 G60 P61 K64 Y53 F54 G57 P58 K61
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lu1, PDBe:6lu1, PDBj:6lu1
PDBsum6lu1
PubMed33686186
UniProtQ8DGB4|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]