Structure of PDB 6l4u Chain L

Receptor sequence
>6l4uL (length=137) [Search protein sequence]
ANFIKPYNDDPFVGHLATPITSSAVTRALLKNLPAYRFGLTPLLRGLEIG
LAHGYFLIGPFVKLGPLRNSDIALIAGFLSTIGLILILTLGLTIYGAAVF
NSTETTLQTRKAWDQFKGGFFVGACGSAGFALICLSS
3D structure
PDB6l4u Structure of photosystem I-light-harvesting supercomplex from a red-lineage diatom
ChainL
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA L I5 T19 I4 T18
BS02 CLA L T19 I21 T22 L30 T18 I20 T21 L29
BS03 CLA L P61 F62 L65 P67 P60 F61 L64 P66
BS04 CLA L P67 A77 L80 S81 P66 A76 L79 S80
BS05 CLA L L89 Y96 L88 Y95
BS06 CLA L L34 P35 A36 I50 A53 H54 F57 L33 P34 A35 I49 A52 H53 F56
BS07 CLA L Y56 F57 G60 P61 K64 L143 Y55 F56 G59 P60 K63 L135
BS08 CLA L N33 R38 E49 N32 R37 E48
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 02:20:05 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6l4u', asym_id = 'L', title = 'Structure of photosystem I-light-harvesting supercomplex from a red-lineage diatom'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6l4u', asym_id='L', title='Structure of photosystem I-light-harvesting supercomplex from a red-lineage diatom')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009522,0009538,0015979', uniprot = '', pdbid = '6l4u', asym_id = 'L'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0009538,0015979', uniprot='', pdbid='6l4u', asym_id='L')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>