Structure of PDB 6kig Chain L

Receptor sequence

>6kigL (length=164) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) [Search protein sequence]

QDVIANGGTPEIGNLATPINSSPFTRTFINALPIYRRGLSSNRRGLEIGM
AHGFLLYGPFSILGPLRNTETAGSAGLLATVGLVVILTVCLSLYGNAGSG
PSAAESTVTTPNPPQELFTKEGWSEFTSGFILGGLGGAFFAFYLASTPYV
QPLVKIAAGVWSVH

3D structure

PDB

6kig Structural basis for energy and electron transfer of the photosystem I-IsiA-flavodoxin supercomplex.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	I6 I21	I4 I19
BS02	CLA	L	L65 W163	L63 W161
BS03	CLA	L	P61 F62 L65 P67	P59 F60 L63 P65
BS04	CLA	L	T19 I21 N22	T17 I19 N20
BS05	CLA	L	I88 Y96	I86 Y94
BS06	CLA	L	P67 L80 G84	P65 L78 G82
BS07	CLA	L	A33 L34 R38 R45 E49 M52	A31 L32 R36 R43 E47 M50
BS08	CLA	L	F30 P35 I50 H54 L57	F28 P33 I48 H52 L55
BS09	CLA	L	F56 G60 P61 I64 L146 L155	F54 G58 P59 I62 L144 L153
BS10	CLA	L	T90 V91 S94	T88 V89 S92

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6kig, PDBe:6kig, PDBj:6kig
PDBsum	6kig
PubMed	32042157
UniProt	P95822\|PSAL_SYNE7 Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]