Structure of PDB 6jy4 Chain L

Receptor sequence
>6jy4L (length=44) Species: 9913 (Bos taurus) [Search protein sequence]
YEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLK
3D structure
PDB6jy4 Monomeric structure of an active form of bovine cytochromecoxidase.
ChainL
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CDL L I11 P12 F13 S14 R20 M25 F28 F29 I9 P10 F11 S12 R18 M23 F26 F27
Gene Ontology
Biological Process
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
Cellular Component
GO:0045277 respiratory chain complex IV

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jy4, PDBe:6jy4, PDBj:6jy4
PDBsum6jy4
PubMed31533957
UniProtP00430|COX7C_BOVIN Cytochrome c oxidase subunit 7C, mitochondrial (Gene Name=COX7C)

[Back to BioLiP]