Structure of PDB 6et5 Chain L

Receptor sequence

>6et5L (length=273) Species: 1079 (Blastochloris viridis)

ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIG
YAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISW
MLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGI
LSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANP
GDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIA
SGPFWTRGWPEWWGWWLDIPFWS

3D structure

• PDB: 6et5 Cryo-EM structure of the Blastochloris viridis LH1-RC complex at 2.9 angstrom.
• Chain: L
• Resolution: 2.87 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCB	L	V157 F160 W167 H168 H173 V177 F241 G244 T248	V157 F160 W167 H168 H173 V177 F241 G244 T248
BS02	BCB	L	F128 F146 H153 L154 V157	F128 F146 H153 L154 V157
BS03	BPB	L	A96 W100 E104 A120 F121 Y148 I150 F241	A96 W100 E104 A120 F121 Y148 I150 F241
BS04	UQ9	L	V182 H190 L193 E212 N213 F216 S223 I224 G225 A226 I229	V182 H190 L193 E212 N213 F216 S223 I224 G225 A226 I229
BS05	FE	L	H190 H230	H190 H230
BS06	BCB	L	H168 M174 V177 S178 M185 V220	H168 M174 V177 S178 M185 V220
BS07	BPB	L	F181 M185	F181 M185
BS08	MQ9	L	Y29 I39 W100	Y29 I39 W100
BS09	UQ9	L	F40 Q87 V91 W142	F40 Q87 V91 W142

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:6et5, PDBe:6et5, PDBj:6et5
• PDBsum: 6et5
• PubMed: 29618818
• UniProt: P06009|RCEL_BLAVI Reaction center protein L chain (Gene Name=pufL)