Structure of PDB 6cas Chain L

Receptor sequence

>6casL (length=124) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEA

3D structure

• PDB: 6cas Aminoglycoside ribosome interactions reveal novel conformational states at ambient temperature.
• Chain: L
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P5 T6 N8 Q9 L10 R12 K13 R15 E16 K17 V18 K20 K21 G29 P31 F32 R33 R34 K46 K47 N49 S50 A51 L52 R53 K54 K57 T61 Y69 G72 E73 R86 K91 X92 P94 R97 R113 K114 K115 S116 R117 S118 K119 T122 K123 K124	P1 T2 N4 Q5 L6 R8 K9 R11 E12 K13 V14 K16 K17 G25 P27 F28 R29 R30 K42 K43 N45 S46 A47 L48 R49 K50 K53 T57 Y65 G68 E69 R82 K87 X88 P90 R93 R109 K110 K111 S112 R113 S114 K115 T118 K119 K120
BS02	MG	L	K114 R117	K110 R113

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6cas, PDBe:6cas, PDBj:6cas
• PDBsum: 6cas
• PubMed: 30113694
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)