Structure of PDB 6boh Chain L

Receptor sequence
>6bohL (length=122) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRG
AVKEGDVVKAVVVRTKKEVKRPDGSAIRFDDNAAVIINNQLEPRGTRVFG
PVARELREKGFMKIVSLAPEVL
3D structure
PDB6boh Conformational Control of Translation Termination on the 70S Ribosome.
ChainL
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L P48 R49 R97 P48 R49 R97
BS02 rna L M1 Q3 Q5 T6 I22 R23 K26 S28 N29 A30 K31 Y32 K44 V57 K67 E68 K70 N82 M1 Q3 Q5 T6 I22 R23 K26 S28 N29 A30 K31 Y32 K44 V57 K67 E68 K70 N82
BS03 MG L K70 R71 K70 R71
BS04 MG L S116 L117 S116 L117
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6boh, PDBe:6boh, PDBj:6boh
PDBsum6boh
PubMed29731232
UniProtQ72I14|RL14_THET2 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]