Structure of PDB 5zgb Chain L

Receptor sequence
>5zgbL (length=119) Species: 280699 (Cyanidioschyzon merolae strain 10D) [Search protein sequence]
PINSSSLTRAYLSQLPIYRRGVSPFLRGLEIGMAHGYFLIGPFVQLGPLR
NTDIKYLAGLLSAIGLIVILTLGMLLYGAVSFTNDSQDLESVDGWRQLAS
GFLLGAVGGAGFAYLLLTL
3D structure
PDB5zgb Unique organization of photosystem I-light-harvesting supercomplex revealed by cryo-EM from a red alga
ChainL
Resolution3.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA L N22 T27 N3 T8
BS02 CLA L P61 F62 L65 P67 P42 F43 L46 P48
BS03 CLA L L68 L80 I83 G84 L49 L61 I64 G65
BS04 CLA L I88 L91 I69 L72
BS05 CLA L Q33 R38 E49 M52 Q14 R19 E30 M33
BS06 CLA L N22 Y30 P35 I50 H54 F57 N3 Y11 P16 I31 H35 F38
BS07 CLA L Y56 F57 G60 P61 Q64 Y37 F38 G41 P42 Q45
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zgb, PDBe:5zgb, PDBj:5zgb
PDBsum5zgb
PubMed29632169
UniProtQ85FP8|PSAL_CYAM1 Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]