Structure of PDB 5yq7 Chain L

Receptor sequence

>5yq7L (length=309) Species: 120962 (Roseiflexus castenholzii)

SAVPRALPLPSGETLPAEAISSTGSQAASAEVIPFSIIEEFYKRPGKTLA
ARFFGVDPFDFWIGRFYVGLFGAISIIGIILGVAFYLYEGVVNEGTLNIL
AMRIEPPPVSQGLNVDPAQPGFFWFLTMVAATIAFVGWLLRQIDISLKLD
MGMEVPIAFGAVVSSWITLQWLRPIAMGAWGHGFPLGITHHLDWVSNIGY
QYYNFFYNPFHAIGITLLFASTLFLHMHGSAVLSEAKRNISDQNIHVFWR
NILGYSIGEIGIHRVAFWTGAASVLFSNLCIFLSGTFVKDWNAFWGFWDK
MPIWNGVGQ

3D structure

• PDB: 5yq7 Cryo-EM structure of the RC-LH core complex from an early branching photosynthetic prokaryote.
• Chain: L
• Resolution: 4.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	L	L173 W269 F283	L172 W268 F282
BS02	BCL	L	W167 F185 H192 L193	W166 F184 H191 L192
BS03	BCL	L	F136 V163 F206 F207 H212 I216 S278 I282	F135 V162 F205 F206 H211 I215 S277 I281
BS04	BPH	L	I80 W139 A159 F160 L187 I189 G271	I79 W138 A158 F159 L186 I188 G270
BS05	MQE	L	H247 W250 S257 I258 G259 E260 I261 I263	H246 W249 S256 I257 G258 E259 I260 I262
BS06	FE	L	H229 H264	H228 H263
BS07	MQE	L	F67 I77 I81 L88	F66 I76 I80 L87
BS08	BPH	L	I216 T217	I215 T216
BS09	BPH	L	L224 H227 M228	L223 H226 M227

Gene Ontology

Molecular Function

• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:5yq7, PDBe:5yq7, PDBj:5yq7
• PDBsum: 5yq7
• PubMed: 29674684
• UniProt: Q83XD0