Structure of PDB 5y88 Chain L

Receptor sequence

>5y88L (length=157) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLW
EIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGY
EKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGC
RGCASTD

3D structure

PDB

5y88 Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae

Chain

Resolution

3.46 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	L	K89 A93 K94 R96 K97	K89 A93 K94 R96 K97
BS02	rna	L	K40 L41 A42 T98 E101 T114 N115 S118 T119 C120 I121 R123 Q128 L129 E132 V146 S155	K40 L41 A42 T98 E101 T114 N115 S118 T119 C120 I121 R123 Q128 L129 E132 V146 S155
BS03	peptide	L	Q54 H57 R126 A127 R151 T156 D157	Q54 H57 R126 A127 R151 T156 D157
BS04	ZN	L	C104 C105 C148	C104 C105 C148
BS05	ZN	L	C104 C150 C153	C104 C150 C153
BS06	ZN	L	C108 C120 C122 C145	C108 C120 C122 C145

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0000282	cellular bud site selection
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005686	U2 snRNP

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5y88, PDBe:5y88, PDBj:5y88
PDBsum	5y88
PubMed	28919079
UniProt	P25337\|BUD31_YEAST Pre-mRNA-splicing factor BUD31 (Gene Name=BUD31)

[Back to BioLiP]