Structure of PDB 5x07 Chain L

Receptor sequence
>5x07L (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
GPHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQ
NSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDS
3D structure
PDB5x07 Structure of the Forkhead Domain of FOXA2 Bound to a Complete DNA Consensus Site
ChainL
Resolution2.796 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna L G155 A158 G1 A4 PDBbind-CN: Kd=105nM
BS02 dna L G155 P156 Q198 G1 P2 Q44 PDBbind-CN: Kd=105nM
BS03 dna L L182 R208 H209 S212 K219 K229 G230 S231 W233 L28 R54 H55 S58 K65 K75 G76 S77 W79 PDBbind-CN: Kd=105nM
BS04 dna L S163 Y164 I165 R202 N205 S206 H209 G228 S9 Y10 I11 R48 N51 S52 H55 G74 PDBbind-CN: Kd=105nM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5x07, PDBe:5x07, PDBj:5x07
PDBsum5x07
PubMed28644006
UniProtQ9Y261|FOXA2_HUMAN Hepatocyte nuclear factor 3-beta (Gene Name=FOXA2)

[Back to BioLiP]