Structure of PDB 5v33 Chain L

Receptor sequence

>5v33L (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYWIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 5v33 X-ray transparent microfluidic chips for high-throughput screening and optimization of in meso membrane protein crystallization.
• Chain: L
• Resolution: 3.487 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	L	W100 E104 A120 F121 Y148 V241	W100 E104 A120 F121 Y148 V241
BS02	BCL	L	Y128 L131 F146 H153 L154	Y128 L131 F146 H153 L154
BS03	BCL	L	F97 A127 L131 V157 T160 H168 H173 I177 F180 S244 A245 M248	F97 A127 L131 V157 T160 H168 H173 I177 F180 S244 A245 M248
BS04	BCL	L	M174 I177 S178 T182	M174 I177 S178 T182
BS05	FE	L	H190 H230	H190 H230
BS06	U10	L	F24 G35 F39 R103	F24 G35 F39 R103
BS07	BPH	L	F181 L185 L189	F181 L185 L189

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:5v33, PDBe:5v33, PDBj:5v33
• PDBsum: 5v33
• PubMed: 28469762
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)