Structure of PDB 5uyp Chain L
Receptor sequence
| >5uypL (length=123) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
| ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA LDCSGVKDRKQARSKYGVKRPKA |
3D structure
| PDB | 5uyp Ensemble cryo-EM elucidates the mechanism of translation fidelity | ||
| Chain | L | ||
| Resolution | 3.9 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | L | N4 Q5 R8 R11 A12 R13 K14 K17 S18 A25 C26 P27 Q28 K29 R30 P44 N45 S46 A47 L48 R49 K50 T57 Y65 G68 E69 G83 V86 K87 D88 R109 K110 Q111 A112 R113 S114 Y116 V118 K119 R120 | N4 Q5 R8 R11 A12 R13 K14 K17 S18 A25 C26 P27 Q28 K29 R30 P44 N45 S46 A47 L48 R49 K50 T57 Y65 G68 E69 G83 V86 K87 D88 R109 K110 Q111 A112 R113 S114 Y116 V118 K119 R120 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0000049 | tRNA binding |
| GO:0003735 | structural constituent of ribosome |
| GO:0005515 | protein binding |
| GO:0019843 | rRNA binding |
| GO:0034336 | misfolded RNA binding |
