Structure of PDB 5umd Chain L

Receptor sequence

>5umdL (length=211) Species: 36329 (Plasmodium falciparum 3D7)

VAHNNVLPNVHLHKWWQHRVRVNFSKNIKKKKRRLLREKRRKANGGTPIE
KLHPIVHCPTQRYNFRTRLGKGFTFEELKGAGLTPRAAQTIGICYDKRRK
NRSEESLTKNVERLLKYKNSLVMIPLKKNKAKKGIGGIPADADKNTIKEF
RNKKPLLSIFKKEKNTKPFYETIEVSKIDKEFLAYKTLRRAKLAERRKNC
RQQKKDIKFKS

3D structure

• PDB: 5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.
• Chain: L
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	V2 A3 H4 N6 V7 P9 N10 V11 H12 L13 H14 K15 W16 W17 Q18 R22 K27 K30 K31 K32 R34 R35 R38 R41 K43 A44 K52 H54 V57 H58 C59 P60 T61 R63 Y64 N65 F66 R67 R69 G71 K72 T85 D97 R99 R100 R103 S104 K129 N130 K133 K134 I136 K145 K149 R152 N166 L184 Y186 K187 R190 R191 K193 R197 R198 N200 C201 R202 Q204 K205 K206 D207 I208 K209 F210 K211	V1 A2 H3 N5 V6 P8 N9 V10 H11 L12 H13 K14 W15 W16 Q17 R21 K26 K29 K30 K31 R33 R34 R37 R40 K42 A43 K51 H53 V56 H57 C58 P59 T60 R62 Y63 N64 F65 R66 R68 G70 K71 T84 D96 R98 R99 R102 S103 K128 N129 K132 K133 I135 K144 K148 R151 N165 L183 Y185 K186 R189 R190 K192 R196 R197 N199 C200 R201 Q203 K204 K205 D206 I207 K208 F209 K210
BS02	rna	L	F25 S26 I29	F24 S25 I28

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5umd, PDBe:5umd, PDBj:5umd
• PDBsum: 5umd
• PubMed: 28288098
• UniProt: Q8IAX6