Structure of PDB 5nj4 Chain L

Receptor sequence

>5nj4L (length=273) Species: 1079 (Blastochloris viridis)

ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIG
YAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISW
MLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGI
LSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANP
GDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIA
SGPFWTRGWPEWWGWWLDIPFWS

3D structure

• PDB: 5nj4 From Macrocrystals to Microcrystals: A Strategy for Membrane Protein Serial Crystallography.
• Chain: L
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCB	L	F97 M127 F128 V157 N158 F160 Y162 W167 H168 H173 S176 V177 F181 F241 G244 T248	F97 M127 F128 V157 N158 F160 Y162 W167 H168 H173 S176 V177 F181 F241 G244 T248
BS02	BCB	L	F128 F146 I150 H153 L154 V157	F128 F146 I150 H153 L154 V157
BS03	BPB	L	I42 I49 W100 E104 A120 F121 P124 Y148 G149 I150 A237 F241	I42 I49 W100 E104 A120 F121 P124 Y148 G149 I150 A237 F241
BS04	FE2	L	H190 H230	H190 H230
BS05	BCB	L	M174 V177 S178	M174 V177 S178
BS06	BPB	L	F181 M185 L189 V220	F181 M185 L189 V220

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:5nj4, PDBe:5nj4, PDBj:5nj4
• PDBsum: 5nj4
• PubMed: 28781082
• UniProt: P06009|RCEL_BLAVI Reaction center protein L chain (Gene Name=pufL)