Structure of PDB 5me1 Chain L

Receptor sequence

>5me1L (length=123) Species: 83333 (Escherichia coli K-12)

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPKA

3D structure

• PDB: 5me1 Structure of a 30S pre-initiation complex stalled by GE81112 reveals structural parallels in bacterial and eukaryotic protein synthesis initiation pathways.
• Chain: L
• Resolution: 13.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	A2 T3 N5 Q6 L7 R12 A13 R14 K18 A26 C27 P28 Q29 K30 R31 K43 K44 N46 S47 A48 R50 K51 T58 Y66 G68 E70 L81 R83 G84 R86 K88 X89 P91 R94 R110 K111 Q112 A113 R114 S115 K116 V119 K120 R121	A1 T2 N4 Q5 L6 R11 A12 R13 K17 A25 C26 P27 Q28 K29 R30 K42 K43 N45 S46 A47 R49 K50 T57 Y65 G67 E69 L80 R82 G83 R85 K87 X88 P90 R93 R109 K110 Q111 A112 R113 S114 K115 V118 K119 R120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0034336 misfolded RNA binding

Biological Process

• GO:0000372 Group I intron splicing
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0033120 positive regulation of RNA splicing
• GO:0034337 RNA folding
• GO:0046677 response to antibiotic
• GO:1990145 maintenance of translational fidelity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5me1, PDBe:5me1, PDBj:5me1
• PDBsum: 5me1
• PubMed: 27986852
• UniProt: P0A7S3|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)