Structure of PDB 5lux Chain L

Receptor sequence
>5luxL (length=62) Species: 9606 (Homo sapiens) [Search protein sequence]
TKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWF
QNRRAKERKVNK
3D structure
PDB5lux Impact of cytosine methylation on DNA binding specificities of human transcription factors.
ChainL
Resolution3.23 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna L T153 K154 R158 V159 Y161 R166 R196 Q197 I200 N204 T1 K2 R6 V7 Y9 R14 R44 Q45 I48 N52
BS02 dna L Y157 R158 V160 Y178 K199 Q203 R206 R210 Y5 R6 V8 Y26 K47 Q51 R54 R58
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5lux, PDBe:5lux, PDBj:5lux
PDBsum5lux
PubMed28473536
UniProtP47902|CDX1_HUMAN Homeobox protein CDX-1 (Gene Name=CDX1)

[Back to BioLiP]