Structure of PDB 5lj3 Chain L

Receptor sequence

>5lj3L (length=155) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWE
IMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGYE
KLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCR
GCAST

3D structure

PDB

5lj3 Cryo-EM structure of the spliceosome immediately after branching.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	L	L90 A93 K94 R96	L89 A92 K93 R95
BS02	rna	L	K40 L41 A42 T98 G99 E101 K102 T114 N115 N116 T119 C120 I121 R123 V124 P125 Q128 L129 C145 V146 H147 S155 T156	K39 L40 A41 T97 G98 E100 K101 T113 N114 N115 T118 C119 I120 R122 V123 P124 Q127 L128 C144 V145 H146 S154 T155
BS03	ZN	L	C104 C105 C108	C103 C104 C107
BS04	ZN	L	C104 C122 C150 C153	C103 C121 C149 C152
BS05	ZN	L	C108 C120 C122 C145	C107 C119 C121 C144

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0000282	cellular bud site selection
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005686	U2 snRNP

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lj3, PDBe:5lj3, PDBj:5lj3
PDBsum	5lj3
PubMed	27459055
UniProt	P25337\|BUD31_YEAST Pre-mRNA-splicing factor BUD31 (Gene Name=BUD31)

[Back to BioLiP]