Structure of PDB 5lbh Chain L

Receptor sequence
>5lbhL (length=143) Species: 213 (Helicobacter cinaedi) [Search protein sequence]
KVVELLKQIQADASVFYVKVHNFHWNVKGMDFHPTHKATQEIYEQFADVF
DDVAERVLQLGEMPYVTLADMLKAAKIKEESKTSFCSKEIAQAVLADYEY
FLKLFTELSAQADSQGDKVSAAYADDKVGELQKAIWMLKSQLA
3D structure
PDB5lbh The Helicobacter cinaedi antigen CAIP participates in atherosclerotic inflammation by promoting the differentiation of macrophages in foam cells.
ChainL
Resolution2.553 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FE L H24 H36 H24 H36
BS02 FE L D51 E55 D51 E55
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 02:17:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5lbh', asym_id = 'L', title = 'The Helicobacter cinaedi antigen CAIP participat...he differentiation of macrophages in foam cells. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5lbh', asym_id='L', title='The Helicobacter cinaedi antigen CAIP participat...he differentiation of macrophages in foam cells. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0008199,0016722', uniprot = '', pdbid = '5lbh', asym_id = 'L'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008199,0016722', uniprot='', pdbid='5lbh', asym_id='L')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>