Structure of PDB 5jbh Chain L

Receptor sequence
>5jbhL (length=102) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
MQKARIKIASTNVRSLDEVANQIKQIAERTGVRMSGPIPLPTKRIRITTR
KSPDGEGSATFDRWELRVHKRLIDIEADERAMRQIMRIRVPEDVTIEIEL
IS
3D structure
PDB5jbh Cryo-EM study of start codon selection during archaeal translation initiation.
ChainL
Resolution5.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L V13 G36 I38 L40 P41 T42 R44 T48 T49 R50 S52 D54 G55 E56 G57 S58 R67 H69 K70 R71 D74 V13 G36 I38 L40 P41 T42 R44 T48 T49 R50 S52 D54 G55 E56 G57 S58 R67 H69 K70 R71 D74
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jbh, PDBe:5jbh, PDBj:5jbh
PDBsum5jbh
PubMed27819266
UniProtP61885|RS10_PYRFU Small ribosomal subunit protein uS10 (Gene Name=rps10)

[Back to BioLiP]