Structure of PDB 5hkv Chain L

Receptor sequence
>5hkvL (length=109) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
ISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGV
TLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLY
HGRVKALAE
3D structure
PDB5hkv Structural insights of lincosamides targeting the ribosome of Staphylococcus aureus.
ChainL
Resolution3.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L S3 R17 L22 I89 K90 I92 R96 S2 R16 L21 I88 K89 I91 R95
BS02 rna L R30 N32 Y34 S36 N37 Q43 V51 T52 Q55 T66 A67 G98 Y99 R29 N31 Y33 S35 N36 Q42 V50 T51 Q54 T65 A66 G97 Y98
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hkv, PDBe:5hkv, PDBj:5hkv
PDBsum5hkv
PubMed28973455
UniProtQ2FW22|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]