Structure of PDB 5dy9 Chain L |
>5dy9L (length=57) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence] |
PNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKH AIDTIEY |
|
PDB | 5dy9 Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii. |
Chain | L |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
AMP |
L |
Y48 H64 |
Y34 H50 |
|
|
|
|