Structure of PDB 4zma Chain L

Receptor sequence
>4zmaL (length=141) Species: 9606 (Homo sapiens) [Search protein sequence]
ANAFLEELRPGSLERECKEEQCSFEEAREIFKDAERTKLFWISYSDGDQC
ASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQ
YCSDHKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKR
3D structure
PDB4zma Molecular Basis of Enhanced Activity in Factor VIIa-Trypsin Variants Conveys Insights into Tissue Factor-mediated Allosteric Regulation of Factor VIIa Activity.
ChainL
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.21.21: coagulation factor VIIa.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA L D46 G47 Q49 D63 Q64 D46 G47 Q49 D63 Q64
BS02 CA L E7 E26 E29 E7 E26 E29
BS03 CA L E7 E16 E26 E29 E7 E16 E26 E29
BS04 CA L A1 N2 E6 E7 E16 E26 A1 N2 E6 E7 E16 E26
BS05 CA L A1 E6 E16 E20 A1 E6 E16 E20
BS06 CA L E14 E19 E14 E19
BS07 BGC L Q49 S52 Q49 S52
BS08 FUC L G58 S60 F71 G58 S60 F71
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4zma, PDBe:4zma, PDBj:4zma
PDBsum4zma
PubMed26694616
UniProtP08709|FA7_HUMAN Coagulation factor VII (Gene Name=F7)

[Back to BioLiP]