Structure of PDB 4yy3 Chain L

Receptor sequence

>4yy3L (length=124) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEA

3D structure

• PDB: 4yy3 mRNA bound to the 30S subunit is a HigB toxin substrate.
• Chain: L
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P5 T6 N8 Q9 R12 K13 R15 E16 K17 R19 K21 K28 P31 F32 R33 R34 K46 K47 N49 S50 A51 L52 R53 K54 T61 Y69 E73 R86 G87 V90 K91 D92 R97 V104 R113 K114 K115 S116 R117 S118 K119 T122 K123 K124	P1 T2 N4 Q5 R8 K9 R11 E12 K13 R15 K17 K24 P27 F28 R29 R30 K42 K43 N45 S46 A47 L48 R49 K50 T57 Y65 E69 R82 G83 V86 K87 D88 R93 V100 R109 K110 K111 S112 R113 S114 K115 T118 K119 K120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4yy3, PDBe:4yy3, PDBj:4yy3
• PDBsum: 4yy3
• PubMed: 27307497
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)