Structure of PDB 4y28 Chain L

Receptor sequence

>4y28L (length=160) Species: 3888 (Pisum sativum) [Search protein sequence]

TYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPGYRTAVNPLLRGIEV
GLAHGFFLVGPFVKAGPLRNTEIAGQAGSLAAAGLVVILSICLTIYGISS
FNEGDPSTAPSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVIWAFF
LLYVLDLPYY

3D structure

PDB

4y28 The structure of plant photosystem I super-complex at 2.8 angstrom resolution.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	L	I147 S151	I95 S99
BS02	CLA	L	A117 P119	A65 P67
BS03	CLA	L	V57 T71	V5 T19
BS04	CLA	L	T71 V73 T74	T19 V21 T22
BS05	CLA	L	I140 Y148	I88 Y96
BS06	CLA	L	P119 L120 L132 A133	P67 L68 L80 A81
BS07	CLA	L	Y82 N85 E101	Y30 N33 E49
BS08	CLA	L	Y82 P87 E101 V102 H106 F109	Y30 P35 E49 V50 H54 F57
BS09	CLA	L	F108 F109 G112 P113 K116 L209 P210 Y211	F56 F57 G60 P61 K64 L157 P158 Y159

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009535	chloroplast thylakoid membrane
GO:0009538	photosystem I reaction center
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4y28, PDBe:4y28, PDBj:4y28
PDBsum	4y28
PubMed	26076232
UniProt	E1C9L1

[Back to BioLiP]