Structure of PDB 4wfb Chain L

Receptor sequence
>4wfbL (length=110) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKG
VTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYL
YHGRVKALAE
3D structure
PDB4wfb Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
ChainL
Resolution3.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L M1 S3 R17 T20 I89 K90 R96 M1 S3 R17 T20 I89 K90 R96
BS02 rna L R11 H15 R19 N32 Y34 R35 S36 N37 Y41 Q43 V51 T52 Q55 A67 G98 Y99 R11 H15 R19 N32 Y34 R35 S36 N37 Y41 Q43 V51 T52 Q55 A67 G98 Y99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wfb, PDBe:4wfb, PDBj:4wfb
PDBsum4wfb
PubMed26464510
UniProtQ2FW22|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]