Structure of PDB 4tyd Chain L

Receptor sequence
>4tydL (length=187) Species: 11104 (Hepatitis C virus (isolate 1)) [Search protein sequence]
ITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVC
WTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSS
DLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVG
IFRAAVCTRGVAKAVDFVPVESMEKGSVVIVGRIILS
3D structure
PDB4tyd Structure-based design of a novel series of azetidine inhibitors of the hepatitis C virus NS3/4A serine protease.
ChainL
Resolution2.84 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H55 D79 G135 S137
Enzyme Commision number 3.6.4.13: RNA helicase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 3EO L P131 S133 Y134 P129 S131 Y132
BS02 ZN L C97 C99 C145 C95 C97 C143
BS03 3EO L Q41 F43 H57 V78 D81 V132 K136 G137 S139 F154 R155 A156 A157 Q39 F41 H55 V76 D79 V130 K134 G135 S137 F152 R153 A154 A155
Gene Ontology
Molecular Function
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis
GO:0019062 virion attachment to host cell
GO:0019087 transformation of host cell by virus
GO:0046718 symbiont entry into host cell
Cellular Component
GO:0016020 membrane
GO:0033644 host cell membrane
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4tyd, PDBe:4tyd, PDBj:4tyd
PDBsum4tyd
PubMed25155387
UniProtQ0ZNA6

[Back to BioLiP]