Structure of PDB 4tma Chain L

Receptor sequence
>4tmaL (length=48) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD
3D structure
PDB4tma Direct control of type IIA topoisomerase activity by a chromosomally encoded regulatory protein.
ChainL
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN L C9 C28 C32 C5 C24 C28
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0008657 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) inhibitor activity
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4tma, PDBe:4tma, PDBj:4tma
PDBsum4tma
PubMed24990966
UniProtP0A8H8|YACG_ECOLI DNA gyrase inhibitor YacG (Gene Name=yacG)

[Back to BioLiP]