Structure of PDB 4io9 Chain L

Receptor sequence

>4io9L (length=104) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSA
ALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAA
REGG

3D structure

PDB

4io9 Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	L11 T13 R14 R15 V17 R18 R26 V88 F89 R91 K95 Y96	L4 T6 R7 R8 V10 R11 R19 V81 F82 R84 K88 Y89
BS02	rna	L	K16 R28 Y32 S34 S35 H37 Y39 Q41 G48 Q49 T50 S55 A58 K64 T65 D66 Y94 K95 H97 G98 R99	K9 R21 Y25 S27 S28 H30 Y32 Q34 G41 Q42 T43 S48 A51 K57 T58 D59 Y87 K88 H90 G91 R92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4io9, PDBe:4io9, PDBj:4io9
PDBsum	4io9
PubMed	23414806
UniProt	Q9RSL2\|RL18_DEIRA Large ribosomal subunit protein uL18 (Gene Name=rplR)