Structure of PDB 4fe1 Chain L

Receptor sequence
>4fe1L (length=151) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
LVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMA
HGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQK
GGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFLLENFLVVDGIMTGLF
N
3D structure
PDB4fe1 Improving the accuracy of macromolecular structure refinement at 7 A resolution.
ChainL
Resolution4.9228 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA L V5 T19 V2 T16
BS02 CLA L H16 I21 S22 I31 H13 I18 S19 I28
BS03 CLA L P61 W62 L65 G66 P67 P58 W59 L62 G63 P64
BS04 CLA L P67 S81 P64 S78
BS05 CA L P67 D70 P64 D67
BS06 CLA L F30 N33 R38 E49 F27 N30 R35 E46
BS07 CLA L F30 L34 P35 A36 V50 H54 F57 F27 L31 P32 A33 V47 H51 F54
BS08 CLA L Y56 F57 G60 P61 L139 F142 Y53 F54 G57 P58 L136 F139
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fe1, PDBe:4fe1, PDBj:4fe1
PDBsum4fe1
PubMed22681901
UniProtQ8DGB4|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]