Structure of PDB 4esv Chain L

Receptor sequence

>4esvL (length=419) Species: 1422 (Geobacillus stearothermophilus)

PPQSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVA
DRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIV
EEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIMEVAFKNIKDIL
VQTYDNIEMLITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALN
IAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPED
WGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYL
QLIQGSGRSKENRQQEVSEISRSLKALARELEVPVIALSQLSRSVEQRQD
KRPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQRNG
PVGTVQLAFIKEYNKFVNL

3D structure

• PDB: 4esv The Hexameric Helicase DnaB Adopts a Nonplanar Conformation during Translocation.
• Chain: L
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.12: DNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	L	N334 Q336 S364 R365 R381 E382 G384	N312 Q314 S342 R343 R359 E360 G362
BS02	GDP	L	Q419 G422 P423	Q397 G400 P401
BS03	GDP	L	S213 G215 K216 T217 A218 R250 K433	S191 G193 K194 T195 A196 R228 K411
BS04	ALF	L	P212 K216 E241	P190 K194 E219

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003678 DNA helicase activity
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016853 isomerase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006260 DNA replication
• GO:0006268 DNA unwinding involved in DNA replication
• GO:0006269 DNA replication, synthesis of primer

Cellular Component

• GO:0005829 cytosol
• GO:1990077 primosome complex

External links

• PDB: RCSB:4esv, PDBe:4esv, PDBj:4esv
• PDBsum: 4esv
• PubMed: 23022319
• UniProt: Q9X4C9|DNAB_GEOSE Replicative DNA helicase DnaB (Gene Name=dnaB)