Structure of PDB 4b3r Chain L

Receptor sequence

>4b3rL (length=124) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEA

3D structure

• PDB: 4b3r 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
• Chain: L
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P1 T2 N4 Q5 L6 R8 R11 E12 R15 K16 K17 K24 G25 P27 F28 R29 R30 K42 K43 N45 S46 A47 L48 R49 K50 T57 Y65 G68 E69 L80 R82 G83 K87 D88 P90 R93 V100 R109 K110 K111 S112 R113 S114 K115 K119 K120	P1 T2 N4 Q5 L6 R8 R11 E12 R15 K16 K17 K24 G25 P27 F28 R29 R30 K42 K43 N45 S46 A47 L48 R49 K50 T57 Y65 G68 E69 L80 R82 G83 K87 D88 P90 R93 V100 R109 K110 K111 S112 R113 S114 K115 K119 K120
BS02	MG	L	P44 N45	P44 N45

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4b3r, PDBe:4b3r, PDBj:4b3r
• PDBsum: 4b3r
• PubMed: 24473108
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)