Structure of PDB 3wmm Chain L

Receptor sequence

>3wmmL (length=280) Species: 1050 (Thermochromatium tepidum)

AMLSFEKKYRVRGGTLIGGDLFDFWVGPFYVGFFGVVGFCFTLLGVLLIV
WGATIGPTGPTSDLQTYNLWRISIAPPDLSYGLRMAPLTEGGLWQIITIC
AAGAFISWALREVEICRKLGIGFHVPFAFSFAIGAYLVLVFVRPLLMGAW
GHGFPYGILSHLDWVSNVGYQFLHFHYNPAHMLAISFFFTNCLALSMHGS
LILSVTNPQKGEPVKTSEHENTFFRDIVGYSIGALAIHRLGLFLALSAAF
WSAVCILISGPFWTRGWPEWWNWWLELPLW

3D structure

• PDB: 3wmm Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom
• Chain: L
• Resolution: 3.008 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	F106 A136 Y137 L140 V166 S167 V169 G170 Y171 F176 H177 H182 I186 F189 S253 A254 I257	F105 A135 Y136 L139 V165 S166 V168 G169 Y170 F175 H176 H181 I185 F188 S252 A253 I256
BS02	BPH	L	F42 I50 A105 W109 E113 V126 F130 Y157 H162	F41 I49 A104 W108 E112 V125 F129 Y156 H161
BS03	UQ8	L	F128 F188 T191 M198 H199 L202 F225 S232 I233 G234 A235 I238 L247 W252	F127 F187 T190 M197 H198 L201 F224 S231 I232 G233 A234 I237 L246 W251
BS04	BCL	L	Y137 F155 I159 H162	Y136 F154 I158 H161
BS05	BCL	L	M183 I186 S187 T191 V229	M182 I185 S186 T190 V228
BS06	BPH	L	C193 L194	C192 L193
BS07	FE	L	H199 H239	H198 H238

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:3wmm, PDBe:3wmm, PDBj:3wmm
• PDBsum: 3wmm
• PubMed: 24670637
• UniProt: D2Z0P3