Structure of PDB 3u32 Chain L

Receptor sequence

>3u32L (length=75) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPM
AILGFALSEATGLFCLMVSFLLLFG

3D structure

PDB

3u32 Structure of the c(10) ring of the yeast mitochondrial ATP synthase in the open conformation.

Chain

Resolution

2.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DCW	L	E59 L63	E59 L63

Gene Ontology

	Molecular Function
GO:0008289	lipid binding
GO:0015078	proton transmembrane transporter activity
GO:0016887	ATP hydrolysis activity
GO:0042802	identical protein binding
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism

	Biological Process
GO:0015986	proton motive force-driven ATP synthesis
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005758	mitochondrial intermembrane space
GO:0005829	cytosol
GO:0016020	membrane
GO:0031966	mitochondrial membrane
GO:0033177	proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)

External links

PDB	RCSB:3u32, PDBe:3u32, PDBj:3u32
PDBsum	3u32
PubMed	22504883
UniProt	P61829\|ATP9_YEAST ATP synthase subunit 9, mitochondrial (Gene Name=OLI1)