Structure of PDB 3pip Chain L

Receptor sequence
>3pipL (length=104) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSA
ALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAA
REGG
3D structure
PDB3pip Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
ChainL
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L K10 L11 T13 R14 R15 R18 R26 V88 R91 Y96 K3 L4 T6 R7 R8 R11 R19 V81 R84 Y89
BS02 rna L R28 S35 H37 Y39 Q41 Q49 T50 T65 S93 Y94 K95 H97 R99 R21 S28 H30 Y32 Q34 Q42 T43 T58 S86 Y87 K88 H90 R92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3pip, PDBe:3pip, PDBj:3pip
PDBsum3pip
PubMed21282615
UniProtQ9RSL2|RL18_DEIRA Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]