Structure of PDB 3n2j Chain L |
>3n2jL (length=128) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLKEGEQYMFFCTFPGGSALMKGTLTLK |
|
PDB | 3n2j Probing the reactivity of different forms of azurin by flavin photoreduction. |
Chain | L |
Resolution | 1.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
L |
H46 C112 M121 |
H46 C112 M121 |
|
|
|
|