Structure of PDB 3jbn Chain L

Receptor sequence

>3jbnL (length=171) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

RDGRHKLRLTGGKKKIHKKKRKYELGRPPSNTKLGSRQVHVVRGRGRNYK
YRAIKLDSGSFSWPTFGISKNTRIIDVVYNASNNELVRTKTLVKNCIVVI
DSHPFTTWYENTFGTTIGKSKNIDPLLLEQFKQGRVLACISSRPGQCGKA
DGYIIEGDELLFYKRKMDKRN

3D structure

PDB

3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

4.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	R5 D6 K10 L11 R12 T14 G16 K17 K18 K19 H21 K22 K23 K24 R25 K26 Y27 L29 R31 P32 P33 S34 Q42 H44 R47 G48 R49 G50 R51 K54 R56 S64 S66 S73 K74 V97 K98 N99 S186 R188 G190 Q191 K194	R1 D2 K6 L7 R8 T10 G12 K13 K14 K15 H17 K18 K19 K20 R21 K22 Y23 L25 R27 P28 P29 S30 Q38 H40 R43 G44 R45 G46 R47 K50 R52 S60 S62 S69 K70 V93 K94 N95 S141 R143 G145 Q146 K149
BS02	rna	L	N88 R92 R180 R210 K216 N218	N84 R88 R135 R165 K169 N171

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum	3jbn
PubMed	26432834
UniProt	Q8IM10

[Back to BioLiP]