Structure of PDB 3jam Chain L

Receptor sequence

>3jamL (length=155) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEG
SYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYE
KRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANK
QFAKF

3D structure

PDB

3jam Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.

Chain

Resolution

3.46 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	Q14 P17 H18 I19 F20 R29 W34 K36 V38 G39 L40 K43 K56 K57 S65 I66 R67 K69 S77 R79 M80 H81 T83 V85 Y90 K96 Y97 R99 K102 R103 H104 K105 N106 Q127 R129 P130 I131 S132 K133 T134 R136 F137 N150 K151 F153 K155 F156	Q13 P16 H17 I18 F19 R28 W33 K35 V37 G38 L39 K42 K55 K56 S64 I65 R66 K68 S76 R78 M79 H80 T82 V84 Y89 K95 Y96 R98 K101 R102 H103 K104 N105 Q126 R128 P129 I130 S131 K132 T133 R135 F136 N149 K150 F152 K154 F155

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jam, PDBe:3jam, PDBj:3jam
PDBsum	3jam
PubMed	26212456
UniProt	Q6CX80

[Back to BioLiP]