Structure of PDB 3j6b Chain L

Receptor sequence

>3j6bL (length=229) Species: 4932 (Saccharomyces cerevisiae)

TVGIARKLSRDKAHRDALLKNLACQLFQHESIVSTHAKCKEASRVAERII
TWTKRAITTSNSVAQAELKSQIQSQLFLAGDNRKLMKRLFSEIAPRYLER
PGGYTRVLRLEPRANDSAPQSVLELVDSPVMSESHTVNRGNLKMWLLVKS
VINDDANQLPHNPLTLQNLHKVAKFKAEAQLHGEIMLIKQVLLKEMSLPY
DEALENERTQALLKEVYSSSSSYVMVPRP

3D structure

• PDB: 3j6b Structure of the yeast mitochondrial large ribosomal subunit.
• Chain: L
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	T2 V3 I5 R7 K8 S10 K13 H15 R16 L19 N22 Q26 H30 I33 S35 T36 H37 A38 K39 R45 E48 R49 T52 W53 R56 N62 E68 S71 Q72 Q74 S75 F78 L79 G81 D82 R84 K85 R101 P102 G103 G104 R107 R110 N116 D117 S118 A119 R140 K144 N163 L165 T166 Q168 N169 K172 K175 F176	T1 V2 I4 R6 K7 S9 K12 H14 R15 L18 N21 Q25 H29 I32 S34 T35 H36 A37 K38 R44 E47 R48 T51 W52 R55 N61 E67 S70 Q71 Q73 S74 F77 L78 G80 D81 R83 K84 R100 P101 G102 G103 R106 R109 N115 D116 S117 A118 R139 K143 N162 L164 T165 Q167 N168 K171 K174 F175

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
• PDBsum: 3j6b
• PubMed: 24675956
• UniProt: P22353|RM08_YEAST Large ribosomal subunit protein bL17m (Gene Name=MRPL8)