Structure of PDB 3dts Chain L

Receptor sequence

>3dtsL (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHAATFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 3dts Structural description of compensatory mutations that restore proton transfer pathways to the L212-L213A mutant bacterial reaction center
• Chain: L
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	I125 A127 V157 F167 H168 H173 I177 F180 S244 M248	I125 A127 V157 F167 H168 H173 I177 F180 S244 M248
BS02	BCL	L	Y128 H153 L154	Y128 H153 L154
BS03	U10	L	I175 S178 F179 H190 L193 F216 S223 I224 G225 I229	I175 S178 F179 H190 L193 F216 S223 I224 G225 I229
BS04	BPH	L	W100 F121 I150 H153 V241	W100 F121 I150 H153 V241
BS05	BCL	L	H168 I177 S178	H168 I177 S178
BS06	BPH	L	F181 L189	F181 L189
BS07	FE	L	H190 H230	H190 H230

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:3dts, PDBe:3dts, PDBj:3dts
• PDBsum: 3dts
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)