Structure of PDB 3dsy Chain L

Receptor sequence

>3dsyL (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHQDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 3dsy Restoring Proton transfer in L212Q mutant of photosynthetic reaction center
• Chain: L
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	F97 A124 I125 A127 L131 F167 H168 H173 I177 F180 S244 M248	F97 A124 I125 A127 L131 F167 H168 H173 I177 F180 S244 M248
BS02	BCL	L	Y128 H153 L154	Y128 H153 L154
BS03	BPH	L	F97 W100 E104 F121 H153 V241	F97 W100 E104 F121 H153 V241
BS04	U10	L	F179 F216 Y222 S223 I224 I229	F179 F216 Y222 S223 I224 I229
BS05	FE	L	H190 H230	H190 H230
BS06	BCL	L	H168 M174 I177 S178 L185	H168 M174 I177 S178 L185
BS07	BPH	L	F181 L189	F181 L189

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:3dsy, PDBe:3dsy, PDBj:3dsy
• PDBsum: 3dsy
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)