Structure of PDB 2wx5 Chain L

Receptor sequence

>2wx5L (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFRTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 2wx5 Structural and Spectroscopic Consequences of Hexa-Coordination of a Bacteriochlorophyll Cofactor in the Rhodobacter Sphaeroides Reaction Centre
• Chain: L
• Resolution: 2.63 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	H168 M174 I177 S178 R181 T182	H168 M174 I177 S178 R181 T182
BS02	BCL	L	F97 A124 A127 V157 F167 H168 H173 I177 S244 M248	F97 A124 A127 V157 F167 H168 H173 I177 S244 M248
BS03	BPH	L	A93 W100 E104 A120 F121 A124 Y148 H153 V241	A93 W100 E104 A120 F121 A124 Y148 H153 V241
BS04	BCL	L	H153 L154	H153 L154
BS05	FE	L	H190 H230	H190 H230
BS06	BPH	L	R181 L185 L189	R181 L185 L189
BS07	U10	L	F29 W100	F29 W100

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:2wx5, PDBe:2wx5, PDBj:2wx5
• PDBsum: 2wx5
• PubMed: 20112981
• UniProt: Q3J1A5|RCEL_CERS4 Reaction center protein L chain (Gene Name=pufL)