Structure of PDB 2wtt Chain L

Receptor sequence
>2wttL (length=46) Species: 9606 (Homo sapiens) [Search protein sequence]
DTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQR
3D structure
PDB2wtt Structural Evolution of P53, P63, and P73: Implication for Heterotetramer Formation.
ChainL
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide L T354 Y355 T2 Y3
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0051262 protein tetramerization
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wtt, PDBe:2wtt, PDBj:2wtt
PDBsum2wtt
PubMed19815500
UniProtO15350|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]