Structure of PDB 2vxj Chain L

Receptor sequence
>2vxjL (length=121) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREH
PDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYND
VPGTYGNNSGSFSVNIGKDQS
3D structure
PDB2vxj Structural Basis of the Preferential Binding for Globo-Series Glycosphingolipids Displayed by Pseudomonas Aeruginosa Lectin I.
ChainL
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BGC L P51 Q53 P51 Q53
BS02 GAL L H50 Q53 H50 Q53
BS03 GLA L Y36 H50 Q53 D100 T104 N107 Y36 H50 Q53 D100 T104 N107
BS04 CA L Y36 D100 T104 N107 N108 Y36 D100 T104 N107 N108
Gene Ontology
Molecular Function
GO:0030246 carbohydrate binding
Biological Process
GO:0007157 heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
Cellular Component
GO:0005737 cytoplasm
GO:0009986 cell surface
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2vxj, PDBe:2vxj, PDBj:2vxj
PDBsum2vxj
PubMed18762193
UniProtQ05097|PA1L_PSEAE PA-I galactophilic lectin (Gene Name=lecA)

[Back to BioLiP]