Structure of PDB 2vxa Chain L

Receptor sequence

>2vxaL (length=66) Species: 1053 (Halorhodospira halophila)

DHVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGG
RVNHWQVTVKVGFTLE

3D structure

• PDB: 2vxa Dodecin is the Key Player in Flavin Homeostasis of Archaea.
• Chain: L
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RBF	L	R46 H48 Q58	R44 H46 Q56

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding

External links

• PDB: RCSB:2vxa, PDBe:2vxa, PDBj:2vxa
• PDBsum: 2vxa
• PubMed: 19224924
• UniProt: A1WUH0|DODEC_HALHL Dodecin (Gene Name=Hhal_0546)